Share this post on:

Product Name :
(Thr²)-Amyloid β-Protein (1-42)

CAS NO. :

Formula :
C204H313N55O61S1

Molecular Weight::
4544.06

Target:

Serial Number:
Asp-Thr-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Short serial number :
DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Purity:
95%

Description :
A mutation very close to the β-secretase cleavage site of APP. The Icelandic mutation A2T of Aβ42 turned out to be less pathogenic than the native sequence. The precursor APP A673T was the first APP variant discovered in humans reducing the risk of Alzheimer’s disease. A2T as well affects γ-secretase cleavage, the mutant was an inefficient substrate in a cell-based assay of the enzyme.

References:
[1]. The A673T mutation in the amyloid precursor protein reduces the production of β-amyloid protein from its β-carboxyl terminal fragment in cells. [2]. A2T and A2V Aβ peptides exhibit different aggregation kinetics, primary nucleation, morphology, structure, and LTP inhibition. [3]. Alzheimer’s Protective Cross-Interaction between Wild-Type and A2T Variants Alters Aβ 42 Dimer Structure. [4].Pathogenic Aβ A2V versus protective Aβ A2T mutation: Early stage aggregation and membrane interaction.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Peresolimab Purity & Documentation
Pembrolizumab (anti-PD-1) supplier
4 Hydroxynonenal Antibody: 4 Hydroxynonenal Antibody is an unconjugated, approximately 0.156 kDa, rabbit-derived, anti-4 Hydroxynonenal polyclonal antibody. 4 Hydroxynonenal Antibody can be used for: WB, ELISA, IHC-P, IF expriments in background without labeling.

Share this post on:

Author: DNA_ Alkylatingdna