Share this post on:

Product Name :
TAT-NSF81scr Fusion Polypeptide, scrambeled

CAS NO. :

Formula :
C169H284N58O48S2

Molecular Weight::
3960.55

Target:

Serial Number:
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Gln-Asp-Gly-Cys-Lys-Tyr-Phe-Ala-Thr-Asp-Glu-Thr-Ile-Met-Lys-Leu-Ser-Ile-Ala-Ile-OH

Short serial number :
YGRKKRRQRRRGGGQDGCKYFATDETIMKLSIAI

Purity:
95%

Description :
It is a scrambled peptide containing the TAT domain and 20 of N-Ethyl-maleimide-sensitive factor 81 (NSF81). TAT-NSF81scr is used to measure the effect of the active and control peptides upon NSF activities and exocytosis.

References:
[1].Matsushita, K. et al. Mol. Pharmacol. 67, 1137 (2005).

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
CD11c Antibody site
Sutimlimab web
Phospho-PDGFR beta (Y740) Antibody: Phospho-PDGFR beta (Y740) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 124 kDa, targeting to Phospho-PDGFR beta (Y740). It can be used for WB,ICC/IF assays with tag free, in the background of Human, Rat.

Share this post on:

Author: DNA_ Alkylatingdna