Share this post on:

Product Name :
(Pyr3)-Amyloid β-Protein (3-42) (TFA)

CAS NO. :

Formula :
C196H299N53O55S.xC2HF3O2

Molecular Weight::
4309.86

Target:
Amyloid-β

Serial Number:
Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Al

Short serial number :
{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Purity:
≥95%

Description :
(Pyr3)-Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer’s disease and Down’s syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

References:
[1]. Takahashi-Ito K, et.al. Memantine inhibits β-amyloid aggregation and disassembles preformed β-amyloid aggregates. Biochem Biophys Res Commun. 2017 Nov 4;493(1):158-163.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Ixekizumab Immunology/Inflammation
3-Nitrotyrosine Antibody Autophagy
Lin28B Antibody: Lin28B Antibody is a non-conjugated and Mouse origined monoclonal antibody about ~27 kDa, targeting to Lin28B. It can be used for WB,ICC,IHC-P assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna