Share this post on:

Product Name :
Amyloid β-Protein (42-1)

CAS NO. :

Formula :
C203H311N55O60S

Molecular Weight::
4514.14

Target:
others

Serial Number:
Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp

Short serial number :
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Purity:
≥95%

Description :
Aβ 1-42, 42-residue fragment of amyloid precursor protein, has been found to be a major constituent of the senile plaques formed in the brains of patients with Alzheimer’s disease and late Down’s syndrome. Aβ 1-42 readily forms neurotoxic oligomers at physiological pH. On the other hand, the peptide shows antimicrobial activity. The sequence of this peptide corresponds to the sequence of human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ42. The peptide has been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer’s disease patients through fluorescence correlation spectroscopy. For detailed descriptions of the preparation of Aβ 1-42 monomers and protofibrils please see the papers of Jan, Hartley, and Lashuel, Stine et al. (2011), and of Broersen and colleagues. The findings of Ryan et al. indicate that 10% ammonia disaggregates Aβ42 more efficiently than HFIP.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
EGFR Rabbit mAb Purity & Documentation
LC3B Rabbit mAb Description
LAMP2 Antibody (YA713): LAMP2 Antibody (YA713) is a non-conjugated and Mouse origined monoclonal antibody about 45 kDa, targeting to LAMP2. It can be used for WB,ICC,IHC-P,FC assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna