Amylin (8-37),rat | DNA_ Alkylatingdna-alkylating.com

Product Name :
Amylin (8-37),rat

CAS NO. :
138398-61-5

Formula :
C140H227N43O43

Molecular Weight::
3200.63

Target:
Amylin Receptor

Serial Number:
Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Short serial number :
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2

Purity:
≥95%

Description :
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.

References:
[1]. Bower RL, et al. Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br J Pharmacol. 2016 Jun;173(12):1883-98. [2]. Hettiarachchi M, et al. Rat amylin-(8-37) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Am J Physiol. 1997 Nov;273(5 Pt 1):E859-67.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Eftilagimod alfa LAG-3
Maftivimab site
MSR1 Antibody: MSR1 Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 50 kDa, targeting to MSR1. It can be used for WB assays with tag free, in the background of Human, Mouse, Rat.

Author: DNA_ Alkylatingdna

Related Posts