[DPro5] Corticotropin Releasing Factor, human, rat | DNA

Product Name :
[DPro5] Corticotropin Releasing Factor, human, rat

CAS NO. :
195628-97-8

Formula :
C208H344N60O63S2

Molecular Weight::
4757.45

Target:
CRFR

Serial Number:
Ser-Glu-Glu-Pro-DPro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2

Short serial number :
SEEP-{D-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Purity:
≥95%

Description :
[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin. [DPro5] Corticotropin Releasing Factor, human, rat fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat.

References:
[1]. Shabanov PD, et al. [Anxiogenic and mnestic effects of corticoliberin and its analogs introduced into the brain ventriculi of rats]. Eksp Klin Farmakol. 2006 Nov-Dec;69(6):3-8. Russian. [2]. Rebaudo R, et al. Electrophysiological effects of sustained delivery of CRF and its receptor agonists in hippocampal slices. Brain Res. 2001 Dec 13;922(1):112-7.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
ATG10 Rabbit mAb Autophagy
CD73 Mouse mAb MedChemExpress
Fatty Acid Synthase Antibody: Fatty Acid Synthase Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 273 kDa, targeting to Fatty Acid Synthase. It can be used for WB,ICC/IF,IHC-P,IP,FC assays with tag free, in the background of Human, Mouse, Rat.

Author: DNA_ Alkylatingdna

Related Posts