3x Hemagglutinin (HA) Tag | DNA_ Alkylatingdna-alkylating.com

Product Name :
3x Hemagglutinin (HA) Tag

CAS NO. :

Formula :
C205H272N38O67S1

Molecular Weight::
4372.63

Target:

Serial Number:
Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH

Short serial number :
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE

Purity:
95%

Description :
3X HA Tag is a biologically active peptide. This tagged peptide can be used to detect proteins and peptides.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Benralizumab site
Anti-Mouse CD19 Antibody (1D3) Technical Information
AMPK alpha 2 Antibody (YA623): AMPK alpha 2 Antibody (YA623) is a non-conjugated and Rabbit origined monoclonal antibody about 62 kDa, targeting to AMPK alpha 2. It can be used for WB,IP assays with tag free, in the background of Human, Rat.

Author: DNA_ Alkylatingdna

Related Posts