Share this post on:

Product Name :
Urotensin I

CAS NO. :
83930-33-0

Formula :
C210H340N62O67S2

Molecular Weight::
4869.45

Target:

Serial Number:
Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2

Short serial number :
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Purity:
95%

Description :
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2β receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2β and mCRF2β receptors, respectively.

References:
[1].Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35. [2].Reul JM, et al. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Curr Opin Pharmacol. 2002 Feb;2(1):23-33. [3].Fryer J, et al. Urotensin I, a CRF-like neuropeptide, stimulates acth release from the teleost pituitary. Endocrinology. 1983;113(6):2308-2310.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
GSDMD Antibody
Calreticulin Antibody
AMPK beta 1 Antibody: AMPK beta 1 Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 30 kDa, targeting to AMPK beta 1. It can be used for WB,IHC-P,FC,IP assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna