Tyr-Proinsulin C-Peptide (55-89) (human) | DNA

Product Name :
Tyr-Proinsulin C-Peptide (55-89) (human)

CAS NO. :
139532-11-9

Formula :
C162H268N50O54

Molecular Weight::
3780.24

Target:
others

Serial Number:
Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg

Short serial number :
YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR

Purity:
≥95%

Description :
Tyr-C-Peptide is derived from genetically modified Arg32Tyr human pro-insulin mutants by trypsin and carboxypeptidase B codigestion.

References:
[1]. Essid SM, et al. Proinsulin C-Peptide Enhances Cell Survival and Protects against Simvastatin-Induced Myotoxicity in L6 Rat Myoblasts. Int J Mol Sci. 2019 Apr 3;20(7).

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Phospho-c-Jun (Ser73) Antibody
TGF alpha Antibody
Alexa Fluor® 647-conjugated AffiniPure Goat Anti-Rabbit IgG H&L : Alexa Fluor® 647-conjugated AffiniPure Goat Anti-Rabbit IgG H&L is a red Alexa Fluor® 647-conjugated and Goat origined monoclonal antibody, targeting to Rabbit IgG antibody. Alexa Fluor® 647-conjugated AffiniPure Goat Anti-Rabbit IgG H&L can binds to the light and heavy chains of Rabbit IgG antibodies, thus can be used for ICC/IF, IHC-F, FC, ELISA assays in the background of Rabbit.

Author: DNA_ Alkylatingdna

Related Posts