Exendin (9-39) | DNA_ Alkylatingdna-alkylating.com

Product Name :
Exendin (9-39)

CAS NO. :
133514-43-9

Formula :
C149H234N40O47S1

Molecular Weight::
3369.83

Target:
GCGR

Serial Number:
Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Short serial number :
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Purity:
≥95%

Description :
Avexitide (Exendin (9-39)) is a specific and competitive GLP-1 receptor antagonist.

References:
[1]. Calabria AC, et al. GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes. 2012 Oct;61(10):2585-91. [2]. De León DD, et al. Exendin-(9-39) corrects fasting hypoglycemia in SUR-1-/- mice by lowering cAMP in pancreatic beta-cells and inhibiting secretion. J Biol Chem. 2008 Sep 19;283(38):25786-93.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
CDT1 Antibody
Caspase 1 Antibody
NLRP3 Antibody: NLRP3 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 118 kDa, targeting to NLRP3 . It can be used for WB,ICC/IF,IHC-P,FC,IP assays with tag free, in the background of Human, Mouse, Rat.

Author: DNA_ Alkylatingdna

Related Posts