Share this post on:

Product Name :
Gastrin Releasing Peptide, procine

CAS NO. :
74815-57-9

Formula :
C126H198N38O31S2

Molecular Weight::
2805.4

Target:
others

Serial Number:
Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2

Short serial number :
APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2

Purity:
≥95%

Description :
GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors.

References:
[1]. McDonald TJ, et al. The effect of gastrin-releasing peptide on the endocrine pancreas. Ann N Y Acad Sci. 1988;547:242-54. [2]. Bostwick DG, Bensch KG. Gastrin releasing peptide in human neuroendocrine tumours. J Pathol. 1985 Dec;147(4):237-44.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Caspase-3 Antibody
Stathmin 1 Antibody (YA049)
BRG1 Antibody (YA817): BRG1 Antibody (YA817) is a non-conjugated and Mouse origined monoclonal antibody about 185 kDa, targeting to BRG1 (6D7). It can be used for WB,ICC/IF,IP assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna