Gastric Inhibitory Peptide (GIP), human | DNA

Product Name :
Gastric Inhibitory Peptide (GIP), human

CAS NO. :
100040-31-1

Formula :
C226H338N60O66S

Molecular Weight::
4983.64

Target:
Insulin Receptor

Serial Number:
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Short serial number :
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Purity:
≥95%

Description :
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

References:
[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13. [2]. Miyachi A, et al. Quantitative analytical method for determining the levels of gastric inhibitory polypeptides GIP1-42 and GIP3-42 in human plasma using LC-MS/MS/MS. J Proteome Res. 2013;12(6):2690-2699. [3]. Gabe MBN, et al. Molecular interactions of full-length and truncated GIP peptides with the GIP receptor – A comprehensive review. Peptides. 2020;125:170224.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Caspase-6 p18 Antibody
Transferrin Receptor 1 Antibody
Phospho-AMPK alpha 2(Ser345) Antibody: Phospho-AMPK alpha 2(Ser345) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 62 kDa, targeting to Phospho-AMPK alpha 2(S345). It can be used for WB,ICC/IF,IHC-P assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts