Galanin (1-29)(rat, mouse) | DNA_ Alkylatingdna-alkylating.com

Product Name :
Galanin (1-29)(rat, mouse)

CAS NO. :
114547-31-8

Formula :
C141H211N43O41

Molecular Weight::
3164.48

Target:
Neuropeptide Y Receptor

Serial Number:
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Short serial number :
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Purity:
≥95%

Description :
Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect.

References:
[1]. Wang S, et al. Cloning and expressional characterization of a novel galanin receptor. Identification of different pharmacophores within galanin for the three galanin receptor subtypes. J Biol Chem. 1997;272(51):31949-31952. [2]. Mazarati A, et al. Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 2006;318(2):700-708.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
DLAT Antibody (YA912)
Vinculin Antibody
Hsc70 Antibody: Hsc70 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 71 kDa, targeting to Hsc70. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Mouse, Rat, Hamster.

Author: DNA_ Alkylatingdna

Related Posts