Product Name :
BNP-32, human
CAS NO. :
124584-08-3
Formula :
C143H244N50O42S4
Molecular Weight::
3464.1
Target:
Natriuretic Peptide
Serial Number:
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys- Val-Leu-Arg-Arg-His(Disulfide bridge:Cys10-Cys26)
Short serial number :
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Purity:
≥95%
Description :
B-type (Brain) natriuretic peptide (BNP) is a 32 amino acid hormone initially isolated from the porcine brain, but mainly produced by the heart ventricles. It is released from a prepro-hormone after cleavage of a signal peptide and further processing by a protease with a conserved recognition sequence (RXXR-S). This cleavage generated NT-proBNP (76aa) and the biologically active 32aa BNP-32, which are secreted in blood in equimolar concentrations.BNP-32 is secreted by cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is known to oppose the renin-angiotensin-aldosterone system and exert vasodilatory effects. This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides.
References:
[1].B-type Natriuretic Peptide: A Review of Its Diagnostic, Prognostic, and Therapeutic Monitoring Value in Heart Failure for Primary Care Physicians. J Am Board Fam Prac . 2003 Jul 08 ; 16(4) 327.R. Cardarelli et al. [2].A new natriuretic peptide in porcine brain. Nature . 1988 Mar 03 ; 332 78.T. Sudoh et al. [3].Natriuretic Peptides—Relevance in Cardiovascular Disease. JAMA . 1998 Dec 16 ; 280(23) 1983.B. Cheung et al. [4].Fortnightly Review: Ten years of natriuretic peptide research: a new dawn for their diagnostic and therapeutic use? BMJ . 1994 Jun 18 ; 308 1615.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
PRMT6 Antibody (YA685)
NLRP3 Antibody
Cdc27 Antibody: Cdc27 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to Cdc27. It can be used for WB,IHC-P assays with tag free, in the background of Human.
