Glucagon-Like Peptide I (7-36), amide, human | DNA

Product Name :
Glucagon-Like Peptide I (7-36), amide, human

CAS NO. :
107444-51-9

Formula :
C149H226N40O45

Molecular Weight::
3297.7

Target:
GCCR

Serial Number:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Short serial number :
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Purity:
≥95%

Description :
Human glucagon-like peptide I amide fragment 7-36 was used in DMEM (Dulbeccos) medium to culture 3T3-L1 adipocytes to study the relationship between adipose tissue GLP-1 receptors and obesity and insulin resistance. GLP-1 (glucagon-like peptide 1) (7-36) amide is a potent insulinotropic peptide that initiates glucose-induced insulin release after a meal or oral glucose. It has antidiabetic effects, so it may be used to treat non-insulin-dependent diabetes.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
PDX1 Antibody
NF-κB p65 Antibody
CXCR3 Antibody: CXCR3 Antibody is an unconjugated, approximately 40 kDa, rabbit-derived, anti-CXCR3 polyclonal antibody. CXCR3 Antibody can be used for: WB expriments in human, mouse, rat, and predicted: dog, pig, cow, rabbit, guinea pig background without labeling.

Author: DNA_ Alkylatingdna

Related Posts