Share this post on:

Product Name :
GHRF, ovine

CAS NO. :
94948-82-0

Formula :
C221H368N72O66S

Molecular Weight::
5121.9

Target:
GHSR

Serial Number:
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2

Short serial number :
YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Purity:
≥95%

Description :
GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH).

References:
[1]. Katz SH, et al. Effect of hypoglycemia on the content of pituitary growth hormone (GH) and hypothalamic growth hormone-releasing factor (GHRF) in the rat. Endocrinology. 1967 Aug;81(2):333-9. [2]. Richardson S, et al. GHRF causes biphasic stimulation of SRIF secretion from rat hypothalamic cells. Am J Physiol. 1988 Dec;255(6 Pt 1):E829-32.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
TNF alpha Antibody
CD73 Antibody (YA797)
Androgen receptor Antibody: Androgen receptor Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 99 kDa, targeting to Androgen receptor. It can be used for WB,ICC/IF assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna