Amyloid β-Protein (1-40)-Lys(biotinyl) amide | DNA

Product Name :
Amyloid β-Protein (1-40)-Lys(biotinyl) amide

CAS NO. :

Formula :
C210H322N58O60S2

Molecular Weight::
4683.29

Target:

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Lys(Biotin)-NH2

Short serial number :
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2

Purity:
95%

Description :
For immobilization of Aβ40. Biotinylation of the peptide as well as the position of the biotin moiety (N- or C-terminus) seem to influence the aggregation behavior. Similar effects have been observed when biotinylating Aβ42 N- or C-terminally.

References:
[1]. A comparative analysis of the aggregation behavior of amyloid-β peptide variants.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
8-OHdG (DNA/RNA Damage) Antibody Purity & Documentation
c-Kit Rabbit pAb supplier
NEDD8 Antibody: NEDD8 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 9 kDa, targeting to NEDD8. It can be used for WB,ICC/IF,IHC-P,IP assays with tag free, in the background of Human, Rat.

Author: DNA_ Alkylatingdna

Related Posts