Share this post on:

Product Name :
(Val³⁴)-Amyloid β-Protein (1-40)

CAS NO. :
1678415-83-2

Formula :
C193H293N53O58S1

Molecular Weight::
4315.78

Target:

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Val-Met-Val-Gly-Gly-Val-Val

Short serial number :
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVGGVV

Purity:
95%

Description :
Cerebral amyloid angiopathy (CAA) is a common finding in Alzheimer’s disease in which amyloid-Aβ vascular deposits are featured in >80% of the cases. Mutations in the positions 21-23 (e.g. Dutch mutation E22Q) are primarily associated with CAA, although they manifest with strikingly different clinical phenotypes: cerebral hemorrhage or dementia. The Piedmont L34V Aβ mutant, located outside this hot spot, shows a similar hemorrhagic phenotype, albeit less aggressive than the widely studied Dutch variant.

References:
[1]. A novel AbetaPP mutation exclusively associated with cerebral amyloid angiopathy. [2].Differential activation of mitochondrial apoptotic pathways by vasculotropic amyloid-beta variants in cells composing the cerebral vessel walls.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
CTX-471 Biological Activity
Hexokinase I (YP6080) Mouse mAb Purity & Documentation
Hsp90 beta Antibody: Hsp90 beta Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 83 kDa, targeting to Hsp90 beta. It can be used for WB,ICC/IF,IHC-P,IP,FC assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna