Share this post on:

Product Name :
Teplow’s Amyloid β-Protein (1-42) (scrambled II)

CAS NO. :
1987844-92-7

Formula :
C203H311N55O60S1

Molecular Weight::
4514.04

Target:
Amyloid-β

Serial Number:
Tyr-His-Ala-Gly-Val-Asp-Lys-Glu-Val-Val-Phe-Asp-Glu-Gly-Ala-Gly-Ala-Glu-His-Gly-Leu-Ala-Gln-Lys-Ile-Val-Arg-Gly-Phe-Gly-Val-Ser-Asp-Val-Ser-Met-Ile-His-Ile-Asn-Leu-Phe

Short serial number :
YHAGVDKEVVFDEGAGAEHGLAQKIVRGFGVSDVSMIHINLF

Purity:
95%

Description :
This peptide is a specifically designed negative control in studies with Abeta42. It is “scrambled”, which means it contains the same amino acids as Abeta42, but in different order. Referring to studies by Yamin and coworkers, Teplow’s Amyloid β-Protein (1-42) does not show a number of phenomena regularly observed with Abeta42 (fibril formation, oligomerization, toxicity to neurons) and furthermore has a relatively flat hydropathy profile, which can be an advantage in several studies, for example in order to avoid unspecific interaction with the cell membrane.

References:
[1].Design, Characterization, and Use of a Novel Amyloid β-Protein Control for Assembly, Neurotoxicity, and Gene Expression Studies.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Atezolizumab medchemexpress
Lipocalin 2 Antibody (YA992) In Vitro
Smad4 Antibody: Smad4 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 60 kDa, targeting to Smad4. It can be used for WB,ICC/IF,IHC-P,FC assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna