Share this post on:

Product Name :
Teplow’s Amyloid β-Protein (1-40) (scrambled II)

CAS NO. :
1987844-71-2

Formula :
C194H295N53O58S1

Molecular Weight::
4329.8

Target:

Serial Number:
Tyr-His-Ala-Gly-Val-Asp-Lys-Glu-Val-Val-Phe-Asp-Glu-Gly-Gly-Ala-Glu-His-Gly-Leu-Ala-Gln-Lys-Ile-Val-Arg-Gly-Phe-Gly-Val-Ser-Asp-Val-Ser-Met-Ile-His-Asn-Leu-Phe

Short serial number :
YHAGVDKEVVFDEGGAEHGLAQKIVRGFGVSDVSMIHNLF

Purity:
95%

Description :
This peptide is a specifically designed negative control in studies with Abeta40. It is “scrambled”, which means it contains the same amino acids as Abeta40, but in different order. Referring to studies by Yamin and coworkers, Teplow’s Amyloid β-Protein (1-40) does not show a number of phenomena regularly observed with Abeta40 (fibril formation, oligomerization, toxicity to neurons) and furthermore has a relatively flat hydropathy profile, which can be an advantage in several studies, for example in order to avoid unspecific interaction with the cell membrane.

References:
[1]. Design, Characterization, and Use of a Novel Amyloid β-Protein Control for Assembly, Neurotoxicity, and Gene Expression Studies.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
VDAC1 Rabbit mAb custom synthesis
AMPK alpha Rabbit mAb Technical Information
mTOR Antibody (YA281): mTOR Antibody (YA281) is a non-conjugated and Rabbit origined monoclonal antibody about 289 kDa, targeting to mTOR. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna