Share this post on:

Product Name :
(Gln²²,Asn²³)-Amyloid β-Protein (1-40)

CAS NO. :
374796-75-5

Formula :
C194H297N55O56S1

Molecular Weight::
4327.83

Target:
Amyloid-β

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Short serial number :
DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV

Purity:
95%

Description :
Transgenic mice expressing the vasculotropic Dutch/Iowa (E693Q/D694N) mutant human Aβ precursor protein in brain (Tg-SwDI) accumulate abundant cerebral microvascular fibrillar amyloid deposits and exhibit robust neuroinflammation. In vitro, the doubly mutated Aβ peptides showed an increased propensity to fibrillation and pathogenicity compared to the Dutch and Iowa single mutants.

References:
[1]. Inhibition of familial cerebral amyloid angiopathy mutant amyloid beta-protein fibril assembly by myelin basic protein. [2].Early-onset subicular microvascular amyloid and neuroinflammation correlate with behavioral deficits in vasculotropic mutant amyloid beta-protein precursor transgenic mice. [3]. Minocycline reduces microglial activation and improves behavioral deficits in a transgenic model of cerebral microvascular amyloid.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Lokivetmab Cancer
Teplizumab medchemexpress
3-Nitrotyrosine Antibody: 3-Nitrotyrosine Antibody is an unconjugated, rabbit-derived, anti-3-Nitrotyrosine polyclonal antibody. 3-Nitrotyrosine Antibody can be used for: WB, ELISA, IHC-P, IHC-F, Flow-Cyt, IF expriments in human, rat, and predicted: mouse background without labeling.

Share this post on:

Author: DNA_ Alkylatingdna