Share this post on:

Product Name :
(Val²)-Amyloid β-Protein (1-42)

CAS NO. :
167114-91-2

Formula :
C205H315N55O60S1

Molecular Weight::
4542.09

Target:

Serial Number:
Asp-Val-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Short serial number :
DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Purity:
95%

Description :
A mutation very close to the β-secretase cleavage site of APP (A673V). Contrary to the protective Icelandic mutation A2T, the recessive A2V mutation may increase the risk of Alzheimer’s disease. Cantu et al. observed that APP A673V is associated with the early onset of AD-type dementia in homozygous individuals, whereas it has a protective effect in the heterozygous state.

References:
[1].Inactivation and intracellular retention of the human I183N mutated melanocortin 3 receptor associated with obesity. [2].High-yield cell-free synthesis of human EGFR by IRES-mediated protein translation in a continuous exchange cell-free reaction format. [3].A2T and A2V Aβ peptides exhibit different aggregation kinetics, primary nucleation, morphology, structure, and LTP inhibition. [4]. Pathogenic Aβ A2V versus protective Aβ A2T mutation: Early stage aggregation and membrane interaction.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
JNK1+JNK2+JNK3 Rabbit mAb Epigenetics
Mepolizumab custom synthesis
TCF7L2/TCF4 Antibody: TCF7L2/TCF4 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 68 kDa, targeting to TCF7L2/TCF4. It can be used for WB,ICC/IF,IHC-P,IP,FC assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna