Share this post on:

Product Name :
Amyloid β-Protein (1-40)

CAS NO. :
119670-30-3

Formula :
C194H295N53O58S1

Molecular Weight::
4329.8

Target:

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Short serial number :
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Purity:
95%

Description :
β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer’s disease.

References:
[1].Amyloid beta peptide 1-40 enhances the action of Toll-like receptor-2 and -4 agonists but antagonizes Toll-like receptor-9-induced inflammation in primary mouse microglial cell cultures. [2]. Redox chemistry of copper-amyloid-beta: the generation of hydroxyl radical in the presence of ascorbate is linked to redox-potentials and aggregation state. [3]. Cerebrospinal fluid Abeta40 and Abeta42: natural course and clinical usefulness.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Beta Actin (Fruit Fly) Antibody Autophagy
DLAT Antibody (YA912) Formula
ASK1 Antibody (YA609): ASK1 Antibody (YA609) is a non-conjugated and Rabbit origined monoclonal antibody about 155 kDa, targeting to ASK1. It can be used for WB,ICC/IF,IHC-P,FC assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna