Share this post on:

Product Name :
醋酸普兰林肽

CAS NO. :
196078-30-5

Formula :
C171H269N51O53S2

Molecular Weight::
3951

Target:
Amylin Receptor

Serial Number:
H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Short serial number :
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY

Purity:
≥98%

Description :
Pramlintide Acetate is the acetate salt form of pramlintide, a peptide analogue of human amylin with 3 proline substitutions at position 25, 28 and 29, with antihyperglycemic activity. By mimicking amylin, pramlintide slows gastric emptying, inhibits digestive secretions (gastric acid, pancreatic enzymes, and bile), reduces glucagon secretion, and increases satiety; all of these actions are mediated mostly by glucose-sensitive areas in the brain stem. The overall result is a decrease in blood glucose levels. The use of pramlintide may cause an increased risk of insulin-induced hypoglycemia.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
PSD95 Rabbit mAb Technical Information
Atacicept Protocol
Heme Oxygenase 1 Antibody: Heme Oxygenase 1 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 33 kDa, targeting to Heme Oxygenase 1(HO-1). It can be used for WB,IHC-P,IP,FC assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna