Share this post on:

Product Name :
利司他肽

CAS NO. :
320367-13-3

Formula :
C215H347N61O65S

Molecular Weight::
4858.5

Target:
Amylin Receptor

Serial Number:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-lle-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys

Short serial number :
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK

Purity:
≥98%

Description :
Lixisenatide is used as adjunct to diet and exercise to treat type 2 diabetes. In the European Union, its use is limited to complementing insulin therapy. As of 2017 it is unclear if they affect a person’s risk of death. It is provided in an autoinjector containing fourteen doses and is injected subcutaneously.Lixisenatide should not be used for people who have problems with stomach emptying. Lixisenatide delays emptying of the stomach, which may change how quickly other drugs that are taken by mouth take effect.

References:
[1].Liu J, Li L, Deng K, Xu C, Busse JW, Vandvik PO, et al. (June 2017). [2]. Cai HY, Yang JT, Wang ZJ, Zhang J, Yang W, Wu MN, Qi JS (January 2018). “Lixisenatide reduces amyloid plaques, neurofibrillary tangles and neuroinflammation in an APP/PS1/tau mouse model of Alzheimer’s disease”. Biochemical and Biophysical Research Communications. 495 (1): 1034–1040.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Galectin 3 Rabbit mAb manufacturer
Pepinemab manufacturer
GATA6 Antibody (YA757): GATA6 Antibody (YA757) is a non-conjugated and Mouse origined monoclonal antibody about 60 kDa, targeting to GATA6 (3H3). It can be used for WB assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna