Share this post on:

Product Name :
TAT-Beclin Scrambled

CAS NO. :

Formula :
C164H251N57O45

Molecular Weight::
3741.10

Target:
HIV

Serial Number:
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val-Gly-Asn-Asp-Phe-Phe-Ile-Asn-His-Glu-Thr-Thr-Gly-Phe-Ala-Thr-Glu-Trp-OH

Short serial number :
YGRKKRRQRRRGGVGNDFFINHETTGFATEW

Purity:
95%

Description :
Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that triggers cell adaptation, survival, or death. When combined with the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control.

References:
[1]. Shoji-Kawata S, et al. Identification of a candidate therapeutic autophagy-inducing peptide. Nature. 2013 Feb 14;494(7436):201-6.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
CD68 Rabbit mAb web
HOPX Antibody Purity & Documentation
Integrin alpha 5 Antibody: Integrin alpha 5 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 115 kDa, targeting to Integrin alpha 5. It can be used for WB,ICC/IF,IHC-P,IP,FC assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna