TAT-HA2 Fusion Peptide | DNA_ Alkylatingdna-alkylating.com

Product Name :
TAT-HA2 Fusion Peptide

CAS NO. :
923954-79-4

Formula :
C149H243N53O39S1

Molecular Weight::
3432.92

Target:
Influenza Virus

Serial Number:
Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH

Short serial number :
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG

Purity:
95%

Description :
It is a cell penetrating peptide consisting of amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2), which is linked to a 10 amino acid cell permeable HIV Trans-activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 can be used as a large molecule drug delivery peptide. TAT PTD binds to the cell surface and penetrates the cell membrane through lipid raft dependent macropinocytosis. The HA2 domain is a pH-sensitive lipid membrane destabilizing sequence that enhances endosomal escape and transduction of the fusion peptide.

References:
[1]. Ya-Jung Lee, et al. Modeling of the endosomolytic activity of HA2-TAT peptides with red blood cells and ghosts. Biochemistry. 2010 Sep 14;49(36):7854-66.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Ku70 Rabbit mAb manufacturer
Galiximab Purity & Documentation
Growth hormone receptor Antibody: Growth hormone receptor Antibody is an unconjugated, approximately 68 kDa, rabbit-derived, anti-Growth hormone receptor polyclonal antibody. Growth hormone receptor Antibody can be used for: WB, ELISA, IHC-P, IHC-F, Flow-Cyt, IF expriments in human, mouse, rat, and predicted: chicken, dog, pig, cow, sheep background without labeling.

Author: DNA_ Alkylatingdna

Related Posts