Share this post on:

Product Name :
Tat-beclin 1

CAS NO. :
1423821-88-8

Formula :
C164H251N57O45

Molecular Weight::
3741.10

Target:
Autophagy/HIV

Serial Number:
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH

Short serial number :
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT

Purity:
95%

Description :
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that triggers cell adaptation, survival, or death. When combined with the cell-permeable peptide, it can successfully enter cells and induce autophagy.

References:
[1]. Sanae Shoji-Kawata, et al. Identification of a Candidate Therapeutic Autophagy-Inducing Peptide. Nature. 2013 Feb 14;494(7436):201-6.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Bcl-XL Rabbit mAb MedChemExpress
Anti-Mouse 4-1BB/CD137 Antibody (3H3) Apoptosis
Calpain 1 Antibody: Calpain 1 Antibody is a non-conjugated and Mouse origined monoclonal antibody about 82 kDa, targeting to Calpain 1. It can be used for ICC,IHC-P,FC assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna