Share this post on:

Product Name :
TAT-NSF222 Fusion Peptide

CAS NO. :
191936-91-1

Formula :
C187H301N67O47

Molecular Weight::
4239.81

Target:
others

Serial Number:
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Asp-Lys-Glu-Phe-Asn-Ser-Ile-Phe-Arg-Arg-Ala-Phe-Ala-Ser-Arg-Val-Phe-Pro-Pro-Glu-OH

Short serial number :
YGRKKRRQRRRGGGLDKEFNSIFRRAFASRVFPPE

Purity:
95%

Description :
This sequence is a N-ethylmaleimide sensitive factor (NSF) peptide that connects to the 11 amino acid cell permeable human immunodeficiency virus (HIV) transactivating regulatory protein (TAT) domain by Gly-Gly-Gly spacer. The peptide contains the NSF domain extending from 222 to 243 amino acids, which is located directly at the amino terminus of the Walker A motif in the NSF D1 domain. ATPase assay shows that TAT-NSF222 inhibits the activity of NSF ATPase.

References:
[1]. Munekazu Yamakuchi, et al. Antibody to human leukocyte antigen triggers endothelial exocytosis. Proc Natl Acad Sci U S A. 2007 Jan 23;104(4):1301-6.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
cIAP2 (YP5071) Mouse mAb Purity & Documentation
IKK alpha/beta Antibody (YA1871) Description
JAK2 Antibody (YA330): JAK2 Antibody (YA330) is a non-conjugated and Rabbit origined monoclonal antibody about 131 kDa, targeting to JAK2. It can be used for WB assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna