TAT-NSF700scr | DNA_ Alkylatingdna-alkylating.com

Product Name :
TAT-NSF700scr

CAS NO. :

Formula :
C186H315N61O44

Molecular Weight::
4109.87

Target:
HIV

Serial Number:
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Ile-Pro-Pro-Val-Tyr-Phe-Ser-Arg-Leu-Asp-Leu-Asn-Leu-Val-Val-Leu-Leu-Leu-Ala-Gln-Leu-OH

Short serial number :
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL

Purity:
95%

Description :
TAT-NSF700scr is used as a control peptide to TAT-NSF700 peptide. Compared with TAT-NSF700, it does not inhibit the disassembly activity of NSF, and TAT-NSF700 plays a key role in regulating exocytosis.

References:
[1]. John W Calvert, et al. Inhibition of N-ethylmaleimide-sensitive factor protects against myocardial ischemia/reperfusion injury. Circ Res. 2007 Dec 7;101(12):1247-54. [2]. Mumtaz, et al. Acute and chronic adaptation of Supraoptic neurons to changes in osmolality. UNIVERSITY OFSASKATCHEWAN, 2011, 05.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Cleaved-PARP1 Rabbit mAb Data Sheet
SIRT2 Rabbit mAb Description
Cy7-conjugated AffiniPure Goat Anti-Mouse IgG H&L: Cy7-conjugated AffiniPure Goat Anti-Mouse IgG H&Lis an -conjugated, goat-derived anti-mouse IgG antibody. Cy7-conjugated AffiniPure Goat Anti-Mouse IgG H&L conjugates the light and heavy chains of mouse IgG antibodies for use in ICC/IF, IHC-F, FC, ELISA experiments in the mouse context.

Author: DNA_ Alkylatingdna

Related Posts