[Pyr11]-Amyloid β-Protein (11-40) | DNA_ Alkylatingdna-alkylating.com

Product Name :
[Pyr11]-Amyloid β-Protein (11-40)

CAS NO. :
192377-94-9

Formula :
C143H226N38O39S

Molecular Weight::
3133.71

Target:
Amyloid-β

Serial Number:
Pyr-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Short serial number :
{Pyr}-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Purity:
≥95%

Description :
(Pyr11)-Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11)-Amyloid β-Protein (11-40) can be used for the research of Alzheimer’s disease.

References:
[1]. He W, et al. The A beta 3-pyroglutamyl and 11-pyroglutamyl peptides found in senile plaque have greater beta-sheet forming and aggregation propensities in vitro than full-length A beta. Biochemistry. 1999 Aug 17;38(33):10871-7.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Keap1 Rabbit mAb Description
MRC1 Antibody manufacturer
Catalase Antibody (YA811): Catalase Antibody (YA811) is a non-conjugated and Mouse origined monoclonal antibody about 60kDa, targeting to Catalase. It can be used for WB,ICC,IHC-P,FC assays with tag free, in the background of Human, Mouse, Rat.

Author: DNA_ Alkylatingdna

Related Posts