Share this post on:

Product Name :
β-Amyloid (1-43)(human)

CAS NO. :
134500-80-4

Formula :
C207H318N56O62S

Molecular Weight::
4615.24

Target:
Amyloid-β

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr

Short serial number :
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT

Purity:
≥95%

Description :
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer’s disease (AD) biomarker together with the others already in use.

References:
[1]. Müller WE, et al., Effects of beta-amyloid peptides on the fluidity of membranes from frontal and parietal lobes of human brain. High potencies of A beta 1-42 and A beta 1-43. Amyloid. 1998;5(1):10-15.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
SATB2 Antibody In stock
MSR1 Rabbit pAb supplier
ERCC1 Antibody (YA770): ERCC1 Antibody (YA770) is a non-conjugated and Mouse origined monoclonal antibody about 33 kDa, targeting to ERCC1 (7F6). It can be used for WB assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna