β-Amyloid (1-38), mouse, rat | DNA_ Alkylatingdna-alkylating.com

Product Name :
β-Amyloid (1-38), mouse, rat

CAS NO. :
186359-66-0

Formula :
C180H273N49O55S

Molecular Weight::
4035.5

Target:
Amyloid-β

Serial Number:
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly

Short serial number :
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG

Purity:
≥95%

Description :
β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.

References:
[1]. Daniel Paris, et al. Reduction of beta-amyloid pathology by celastrol in a transgenic mouse model of Alzheimer’s disease. J Neuroinflammation. 2010 Mar 8;7:17.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Mitofusin 2 Rabbit pAb In Vivo
JAK2 Rabbit mAb custom synthesis
GABARAP Antibody: GABARAP Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 14 kDa, targeting to GABARAP. It can be used for WB,IHC-P,FC assays with tag free, in the background of Human, Mouse, Rat.

Author: DNA_ Alkylatingdna

Related Posts