β- Amyloid (1-38) | DNA_ Alkylatingdna-alkylating.com

Product Name :
β- Amyloid (1-38)

CAS NO. :
131438-74-9

Formula :
C184H277N51O56S

Molecular Weight::
4131.63

Target:
Amyloid-β

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly

Short serial number :
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Purity:
≥95%

Description :
β- Amyloid (1-38) is a β-Amyloid peptide consists of 38 amino acid.

References:
[1].A screening UHPLC–MS/MS method for the analysis of amyloid peptides in cerebrospinal fluid of preclinical species.Bioanalysis . 2010 Dec 23 ; 3(1) 45 [2].Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease.Anal Chem . 2010 Sep 15 ; 82(18) 7611

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Casirivimab Autophagy
Patritumab deruxtecan Autophagy
IKK alpha Antibody: IKK alpha Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 85 kDa, targeting to IKK alpha. It can be used for WB,ICC/IF,IHC-P,FC,IP assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts