Share this post on:

Product Name :
[Gly22]-Amyloid β-Protein (1-42)

CAS NO. :
1802086-23-2

Formula :
C200H307N55O58S

Molecular Weight::
4442.07

Target:
Amyloid-β

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Short serial number :
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA

Purity:
≥95%

Description :
(Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer’s disease. Mutation of Glu22 to Gly22 in Aβ can increase aggregation.

References:
[1]. Poduslo JF, et al. Receptor-mediated transport of human amyloid beta-protein 1-40 and 1-42 at the blood-brain barrier. Neurobiol Dis. 1999 Jun;6(3):190-9. [2]. Xiaoling Lin, et al. Identification of novel oligopeptides from the simulated digestion of sea cucumber (Stichopus japonicus) to alleviate Aβ aggregation progression. Journal of Functional Foods. Volume 60, September 2019, 103412

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Adiponectin Rabbit mAb In Vivo
Synaptophysin (Y20P21) Mouse mAb Biological Activity
Oct-4 Antibody (YA837): Oct-4 Antibody is a non-conjugated and Mouse origined monoclonal antibody about 39 kDa, targeting to POU5F1. It can be used for WB,ICC assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna