Share this post on:

Product Name :
Cys-β- Amyloid (1 – 40)

CAS NO. :

Formula :
C197H299N54O59S2

Molecular Weight::
4432.03

Target:
Amyloid-β

Serial Number:
Cys-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Short serial number :
CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Purity:
≥95%

Description :
Cys-β- Amyloid (1 – 40) can be easily and selectively modified, labeled, coupled to carriers e.g. by maleimide chemistry without affecting the sequences involved in fibril formation. The free mercapto moiety of the peptide adheres to gold surfaces.

References:
[1]Identification of glucagon-like peptide-2 (GLP-2)-activated signaling pathways in baby hamster kidney fibroblasts expressing the rat GLP-2 receptor. B.Yusta et al., J. Biol. Chem., 274, 30459 (1999) [2]Functionalization of gold nanoparticles with amino acid, beta-amyloid peptides and fragment. A.Majzik et al., Colloids Surf. B, 81, 235 (2010)

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Burosumab manufacturer
Panitumumab (anti-EGFR) site
Histone H3 (mono methyl K18) Antibody: Histone H3 (mono methyl K18) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 15 kDa, targeting to Histone H3 (mono methyl K18). It can be used for WB,ICC/IF,IHC-P assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna