Share this post on:

Product Name :
Amyloid β/A4 Protein Precursor770 (740-770)

CAS NO. :
1802086-24-3

Formula :
C162H243N45O52S2

Molecular Weight::
3717.14

Target:
others

Serial Number:
Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn

Short serial number :
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Purity:
≥95%

Description :
Amyloid β/A4 Protein Precursor₇₇₀ (740-770) corresponds to a C-terminal amyloid precursor protein (APP) fragment known as C31. This fragment is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer’s disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Biotin-conjugated Anti-Rabbit IgG H&L Purity & Documentation
PU.1 Rabbit mAb web
Phospho-GSK3 beta (Ser9) Antibody: Phospho-GSK3 beta (Ser9) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 47 kDa, targeting to Phospho-GSK3 beta (Ser9). It can be used for WB,IHC-F,IHC-P,ICC/IF assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna