Share this post on:

Product Name :
β-Amyloid Peptide (1-42), rat

CAS NO. :
166090-74-0

Formula :
C199H307N53O59S

Molecular Weight::
4418.05

Target:
Amyloid-β

Serial Number:
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Short serial number :
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Purity:
≥95%

Description :
β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer’s disease.

References:
[1]. Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87(6):521-5. [2]. Lagunes T, et al. Abeta(1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86(4):1927-34. [3]. Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25(18-19):3186-94.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Crovalimab site
Sutimlimab Epigenetic Reader Domain
Hsc70 Antibody: Hsc70 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 71 kDa, targeting to Hsc70. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Mouse, Rat, Hamster.

Share this post on:

Author: DNA_ Alkylatingdna