β-Amyloid (1-40), rat | DNA_ Alkylatingdna-alkylating.com

Product Name :
β-Amyloid (1-40), rat

CAS NO. :
144409-98-3

Formula :
C190H291N51O57S

Molecular Weight::
4233.81

Target:
Amyloid-β; Apoptosis

Serial Number:
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Short serial number :
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

Purity:
≥95%

Description :
β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer’s disease (AD). β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer’s disease.

References:
[1]. MacManus A, et, al. Enhancement of (45)Ca(2+) influx and voltage-dependent Ca(2+) channel activity by beta-amyloid-(1-40) in rat cortical synaptosomes and cultured cortical neurons. Modulation by the proinflammatory cytokine interleukin-1beta. J Biol Chem . [2]. Miguel-Hidalgo JJ, et, al. Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 1998 May;95(5):455-65. [3]. Prediger RD, et, al. Differential susceptibility following beta-amyloid peptide-(1-40) administration in C57BL/6 and Swiss albino mice: Evidence for a dissociation between cognitive deficits and the glutathione system response. Behav Brain Res. 2007 Feb 2 .

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Phospho-EGFR(Y1068) Rabbit mAb custom synthesis
Phospho-AKT (Thr308) Rabbit pAb Purity
Glutamine Synthetase Antibody (YA751): Glutamine Synthetase Antibody (YA751) is a non-conjugated and Mouse origined monoclonal antibody about 42 kDa, targeting to Glutamine Synthetase. It can be used for WB,IHC-P,FC assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts