β- Amyloid (1-40) | DNA_ Alkylatingdna-alkylating.com

Product Name :
β- Amyloid (1-40)

CAS NO. :
131438-79-4

Formula :
C194H295N53O58S

Molecular Weight::
4329.82

Target:
Amyloid-β

Serial Number:
Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Short serial number :
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Purity:
≥95%

Description :
β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer’s disease.

References:
[1]. Shoji M, et al. Cerebrospinal fluid Abeta40 and Abeta42: natural course and clinical usefulness. Front Biosci. 2002 Apr 1;7:d997-1006. [2]. Cleary J, et al. Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 1995 Jun 5;682(1-2):69-74. [3]. Olariu A, et al. Memory impairment induced by chronic intracerebroventricular infusion of beta-amyloid (1-40) involves downregulation of protein kinase C. Brain Res. 2002 Dec 13;957(2):278-86.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
SIRT6 Rabbit mAb Protocol
Cathepsin D Rabbit mAb Cancer
SOX11 Antibody: SOX11 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 47 kDa, targeting to SOX11. It can be used for WB,ICC/IF,IP assays with tag free, in the background of Human, Mouse, Rat.

Author: DNA_ Alkylatingdna

Related Posts