Share this post on:

Product Name :
Amylin (IAPP)(Feline)

CAS NO. :

Formula :
C165H270N52O54S2

Molecular Weight::
3910.45

Target:
Amylin Receptor

Serial Number:
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2(Disulfide bridge:Cys2-Cys7)

Short serial number :
KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)

Purity:
≥95%

Description :
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion.

References:
[1]. Westermark P, et al. Islet amyloid polypeptide, islet amyloid, and diabetes mellitus. Physiol Rev. 2011 Jul;91(3):795-826.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Gosuranemab site
Depatuxizumab Protein Tyrosine Kinase/RTK
FosB Antibody: FosB Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 36 kDa, targeting to FosB. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna