Apelin-36, human | DNA_ Alkylatingdna-alkylating.com

Product Name :
Apelin-36, human

CAS NO. :
252642-12-9

Formula :
C184H297N69O43S

Molecular Weight::
4195.92

Target:
others

Serial Number:
Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe

Short serial number :
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Purity:
≥95%

Description :
Apelin-36 (human) is an endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
CD44 Rabbit mAb web
Ki-67 Antibody Protocol
Phospho-BTK(Y223) Antibody: Phospho-BTK(Y223) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 76 kDa, targeting to Phospho-BTK(Y223). It can be used for WB, IHC-P, IHC-F, ICC, IF assays with tag free, in the background of Human.

Author: DNA_ Alkylatingdna

Related Posts