TAT-NSF222scr Fusion Polypeptide scrambled | DNA

Product Name :
TAT-NSF222scr Fusion Polypeptide scrambled

CAS NO. :

Formula :
C190H298N64O46

Molecular Weight::
4214.8

Target:
others

Serial Number:
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Glu-Asn-Ser-Phe-Arg-Phe-Leu-Ala-Asp-Ile-Phe-Pro-Ala-Lys-Ala-Phe-Pro-Val-Arg-Phe-Glu-OH

Short serial number :
YGRKKRRQRRRGGGENSFRFLADIFPAKAFPVRFE

Purity:
95%

Description :
It is a scrambled TAT-NSF222scr fusion polypeptide. It consists of 11 amino acids from the cell permeable human immunodeficiency virus TAT polypeptide, 3 glycines as a linker, followed by scrambled N-Ethyl-maleimide-sensitive factor (NSF) D1 domain. It is used as a control for the TAT-NSF222 peptide.

References:
[1]. Matsushita K, et al. Nitric oxide regulates exocytosis by S-nitrosylation of N-ethylmaleimide-sensitive factor. Cell. 2003 Oct 17;115(2):139-50.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Nipocalimab References
14-3-3 eta (YP4052) Mouse mAb manufacturer
MYSM1 Antibody: MYSM1 Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 95 kDa, targeting to MYSM1. It can be used for WB,IHC-P assays in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts