Proadrenomedullin (45-92) (human) | DNA_ Alkylatingdna-alkylating.com

Product Name :
Proadrenomedullin (45-92) (human)

CAS NO. :
166798-69-2

Formula :
C215H359N67O73S2

Molecular Weight::
5114.76

Target:
others

Serial Number:
Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val

Short serial number :
ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV

Purity:
≥95%

Description :
Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products

References:
[1]. Lorubbio M, et al. Midregional pro-adrenomedullin (MR-ProADM) reference values in serum. Clin Biochem. 2018 Mar;53:173-174. [2]. Al-Omari MA, et al. Mid-regional pro-adrenomedullin is associated with pulse pressure, left ventricular mass, and albuminuria in African Americans with hypertension. Am J Hypertens. 2009 Aug;22(8):860-6.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
c-Kit Rabbit pAb manufacturer
Amubarvimab custom synthesis
Glucose 6 Phosphate Dehydrogenase Antibody: Glucose 6 Phosphate Dehydrogenase Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 59 kDa, targeting to Glucose 6 Phosphate Dehydrogenase. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Rat.

Author: DNA_ Alkylatingdna

Related Posts