Share this post on:

Product Name :
Adrenomedullin (1-50), rat

CAS NO. :
159964-38-2

Formula :
C248H381N77O75S5

Molecular Weight::
5729.5

Target:
CGRP Receptor

Serial Number:
Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge:Cys14-Cys19 )

Short serial number :
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19)

Purity:
≥95%

Description :
Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor.

References:
[1]. Berthiaume N, et al. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors in the double-perfused mesenteric bed of the rat. Can J Physiol Pharmacol. 1995 Jul;73(7):1080-3. [2]. Qi JG, et al. Effect of adrenomedullin 1-50 on chronic hypoxic pulmonary hypertension in rats. Beijing Da Xue Xue Bao Yi Xue Ban. 2006 Apr 18;38(2):151-4.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Elezanumab TGF-beta/Smad
PI3 Kinase p110 beta Antibody web
Pan-Cadherin Antibody: Pan-Cadherin Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 100 kDa, targeting to Pan-Cadherin. It can be used for WB,ICC/IF,IHC-P,IP,FC assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna