Share this post on:

Product Name :
ACTH (7- 38), human

CAS NO. :
68563-24-6

Formula :
C167H257N47O46

Molecular Weight::
3659.2

Target:
Melanocortin receptor

Serial Number:
Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu

Short serial number :
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLQ

Purity:
≥95%

Description :
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity.

References:
[1]. Verma PS, et.al. Inhibition of canine lung angiotensin converting enzyme by ACTH and structurally related peptides. Biochem Biophys Res Commun. 1982 Feb 26;104(4):1484-8.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Histone H3 (acetyl K56) Rabbit mAb Formula
Telisotuzumab References
Methionine Aminopeptidase 2 Antibody: Methionine Aminopeptidase 2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 53 kDa, targeting to Methionine Aminopeptidase 2. It can be used for WB,ICC,IF,IHC-P,FC assays with tag free, in the background of Human, Mouse, Rat.

Share this post on:

Author: DNA_ Alkylatingdna