Share this post on:

Product Name :
ACTH (1-39), mouse, rat

CAS NO. :
77465-10-2

Formula :
C210H315N57O57S

Molecular Weight::
4582.3

Target:
Melanocortin receptor

Serial Number:
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe

Short serial number :
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

Purity:
≥95%

Description :

References:
[1]. Lisak RP, et al. Melanocortin receptor agonist ACTH 1-39 protects rat forebrain neurons from apoptotic, excitotoxic and inflammation-related damage. Exp Neurol. 2015 Nov;273:161-7. [2]. Schulz C, et al. Endogenous ACTH, not only alpha-melanocyte-stimulating hormone, reduces food intake mediated by hypothalamic mechanisms. Am J Physiol Endocrinol Metab. 2010 Feb;298(2):E237-44.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
CD34 Antibody Cancer
Brentuximab vedotin (solution) Data Sheet
Phospho-RSK1 p90 (Ser380) Antibody: Phospho-RSK1 p90 (Ser380) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 83 kDa, targeting to Phospho-RSK1 p90 (Ser380). It can be used for WB, ICC/IF, IP assays with tag free, in the background of Human, Mouse and Rat.

Share this post on:

Author: DNA_ Alkylatingdna