Share this post on:

Product Name :
GLP-1 (7-37)

CAS NO. :
106612-94-6

Formula :
C151H228N40O47

Molecular Weight::
3355.67

Target:
GCGR

Serial Number:
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH (trifluoroacetate salt)

Short serial number :
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Purity:
≥98%

Description :
Glucagon-like peptide-1, GLP-1) is a hormone mainly produced by intestinal L cells, belonging to incretin (incretin), glucagon-like peptide-1 receptor agonist (GLP-1RA) is a new hypoglycemic drug in recent years, by activating GLP-1 receptor, enhancing insulin secretion in a glucose concentration-dependent manner, inhibiting glucagon secretion, and can delay gastric emptying, reduce food intake through central appetite suppression, so as to achieve blood sugar, weight loss and other effects.

References:
[1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004). [2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Cleaved-Caspase 1 Rabbit pAb Technical Information
GLP-1R Antibody References
Glutathione Reductase Antibody: Glutathione Reductase Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 56 kDa, targeting to Glutathione Reductase. It can be used for WB assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna