Tyr-CRF (ovine) | DNA_ Alkylatingdna-alkylating.com

Product Name :
Tyr-CRF (ovine)

CAS NO. :
83930-34-1

Formula :
C214H348N60O65S

Molecular Weight::
4833.59

Target:
CRFR

Serial Number:
Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

Short serial number :
YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

Purity:
≥95%

Description :
Tyr-CRF (ovine) is a corticotropin releasing factor/hormone isolated from ovine. CRF is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin.

References:
[1]. Schulte HM, et al. Metabolic clearance rate and plasma half-life of radioiodinated corticotropin releasing factor in a primate. J Clin Endocrinol Metab. 1982 Nov;55(5):1023-5. [2]. Rebaudo R, et al. Electrophysiological effects of sustained delivery of CRF and its receptor agonists in hippocampal slices. Brain Res. 2001 Dec 13;922(1):112-7.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Faricimab Purity & Documentation
ATF2 Rabbit mAb supplier
Mst2 Antibody: Mst2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 56 kDa, targeting to Mst2. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Mouse.

Author: DNA_ Alkylatingdna

Related Posts