Albiglutide amide | DNA_ Alkylatingdna-alkylating.com

Product Name :
Albiglutide amide

CAS NO. :
224638-84-0

Formula :
C148H224N40O45

Molecular Weight::
3283.60

Target:
GLP Receptor

Serial Number:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Short serial number :
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Purity:
95%

Description :
8-Glycine-36-L-argininamide-7-36-Glucagon-like peptide 1 (Octodon degus) TFA is a long acting GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus (T2DM).

References:
[1]. Matthews JE, et al. Pharmacodynamics, pharmacokinetics, safety, and tolerability of albiglutide, a long-acting glucagon-like peptide-1 mimetic, in patients with type 2 diabetes. J Clin Endocrinol Metab. 2008 Dec;93(12):4810-7. [2]. Blair HA, et al. Albiglutide: a review of its use in patients with type 2 diabetes mellitus. Drugs. 2015 Apr;75(6):651-63. [3]. Trujillo JM, et al. Albiglutide: a new GLP-1 receptor agonist for the treatment of type 2 diabetes. Ann Pharmacother. 2014 Nov;48(11):1494-501. [4]. Doyle ME, et al. Insertion of an N-terminal 6-aminohexanoic acid after the 7 amino acid position of glucagon-like peptide-1 produces a long-acting hypoglycemic agent. Endocrinology. 2001 Oct;142(10):4462-8.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
RUNX Rabbit mAb manufacturer
Tanezumab Epigenetic Reader Domain
Phospho-c-Jun(Ser63) Antibody: Phospho-c-Jun(Ser63) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 36 kDa, targeting to Phospho-c-Jun(S63). It can be used for WB,ICC,IHC-P assays with tag free, in the background of Human.

Author: DNA_ Alkylatingdna

Related Posts